- C8B Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-85990
- Human
- Unconjugated
- C82
- 0.1 ml
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- C8B
- PBS (pH 7.2) and 40% Glycerol
- This antibody was developed against Recombinant Protein corresponding to amino acids: PCQGNGVPVL KGSRCDCICP VGSQGLACEV SYRKNTPIDG KWNCWSNWSS CSGRRKTRQR QCNNPPPQNG GSPCSGPASE TLDCS
- Rabbit
- complement C8 beta chain
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Cardiovascular Biology, Immunology, Innate Immunity, Neurodegeneration, Neuroscience
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
PCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS
Specifications/Features
Available conjugates: Unconjugated